missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Collagen XVII Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-38686-25ul
This item is not returnable.
View return policy
Description
Collagen XVII Polyclonal specifically detects Collagen XVII in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.
Specifications
| Collagen XVII | |
| Polyclonal | |
| Immunohistochemistry, Immunohistochemistry-Paraffin 1:20 - 1:50 | |
| Q9UMD9 | |
| COL17A1 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: NLPSHVWSSTLPAGSSMGTYHNNMTTQSSSLLNTNAYSAGSVFGVPNNMASCSPTLHPGLSTSSSVFGMQNNLAPSLTTLSHGTTTTSTA | |
| 25 μL | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4°C short term. Aliquot and store at-20°C long term. Avoid freeze/thaw cycles. |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 180 kDa bullous pemphigoid antigen 2, BA16H23.2, BP180alpha 1 type XVII collagen, BPAG2bA16H23.2 (collagen, type XVII, alpha 1 (BP180)), Bullous pemphigoid antigen 2, bullous pemphigoid antigen 2 (180kD), Collagen 17, collagen alpha-1(XVII) chain, collagen XVII, alpha-1 polypeptide, collagen, type XVII, alpha 1, Collagen-17, FLJ60881, KIAA0204, LAD-1 | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| 1308 | |
| Human | |
| IgG |
Korrektion af produktindhold
Dit input er vigtigt for os. Udfyld denne formular for at give feedback relateret til indholdet på dette produkt.
Produkttitel
Ser du en mulighed for forbedring?Del en indholdskorrektion