missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Collagen XVII Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-38686-25ul
This item is not returnable.
View return policy
Description
Collagen XVII Polyclonal specifically detects Collagen XVII in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.
Specifications
| Collagen XVII | |
| Polyclonal | |
| Immunohistochemistry, Immunohistochemistry-Paraffin 1:20 - 1:50 | |
| Q9UMD9 | |
| COL17A1 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: NLPSHVWSSTLPAGSSMGTYHNNMTTQSSSLLNTNAYSAGSVFGVPNNMASCSPTLHPGLSTSSSVFGMQNNLAPSLTTLSHGTTTTSTA | |
| 25 μL | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4°C short term. Aliquot and store at-20°C long term. Avoid freeze/thaw cycles. |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 180 kDa bullous pemphigoid antigen 2, BA16H23.2, BP180alpha 1 type XVII collagen, BPAG2bA16H23.2 (collagen, type XVII, alpha 1 (BP180)), Bullous pemphigoid antigen 2, bullous pemphigoid antigen 2 (180kD), Collagen 17, collagen alpha-1(XVII) chain, collagen XVII, alpha-1 polypeptide, collagen, type XVII, alpha 1, Collagen-17, FLJ60881, KIAA0204, LAD-1 | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| 1308 | |
| Human | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction