missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ COL4A6 (Human) Recombinant Protein

Human COL4A6 full-length ORF ( AAH05305, 23 a.a. - 73 a.a.) recombinant protein with GST-tag at N-terminal.

Brand:  Abnova™ H00001288-P02.10ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16103381

  • 335.00€ / 10µg
Estimated Shipment: 04-07-2024
to see stock.
Add to basket

Description

Description

  • Sequence: GEKSYGKPCGGQDCSGSCQCFPEKGARHNLQLLNDMAGRLYHFSEVLPNLF
Specifications

Specifications

AAH05305
collagen, type IV, alpha 6
125% SDS-PAGE Stained with Coomassie Blue
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
COL4A6
GST
1288
Wheat germ expression system
10 μg
MGC88184
Wheat Germ (in vitro)
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer
Product Suggestions

Product Suggestions

Videos
SDS
Documents

Documents

Certificates
Special Offers

Special Offers