missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Clathrin light chain + heavy chain Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
483.00€
Specifications
| Antigen | Clathrin light chain + heavy chain |
|---|---|
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Regulatory Status | RUO |
Description
Clathrin light chain + heavy chain Polyclonal specifically detects Clathrin light chain + heavy chain in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| Clathrin light chain + heavy chain | |
| Unconjugated | |
| RUO | |
| clathrin light chain A, clathrin, light chain A, LCA, light polypeptide (Lca) | |
| CLTA | |
| IgG | |
| 24 kDa |
| Polyclonal | |
| Rabbit | |
| Membrane Trafficking and Chaperones, Membrane Vesicle Markers | |
| 1211 | |
| Synthetic peptides corresponding to CLTA (clathrin, light chain (Lca)) The peptide sequence was selected from the C terminal of CLTA. Peptide sequence KELEEWYARQDEQLQKTKANNRAAEEAFVNDIDESSPGTEWERVARLCDF. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title