missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Cklfsf8 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
483.00€
Specifications
| Antigen | Cklfsf8 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
Cklfsf8 Polyclonal specifically detects Cklfsf8 in Human samples. It is validated for Western Blot.Specifications
| Cklfsf8 | |
| Polyclonal | |
| Rabbit | |
| Cytokine Research | |
| chemokine-like factor super family 8, chemokine-like factor superfamily 8, Chemokine-like factor superfamily member 8, CKLF-like MARVEL transmembrane domain containing 8, CKLF-like MARVEL transmembrane domain-containing protein 8, CKLFSF8, CKLFSF8-V2 | |
| CMTM8 | |
| IgG |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Q8IZV2 | |
| 152189 | |
| Synthetic peptides corresponding to CMTM8(CKLF-like MARVEL transmembrane domain containing 8) The peptide sequence was selected from the middle region of CMTM8. Peptide sequence CFNGSAFVLYLSAAVVDASSVSPERDSHNFNSWAASSFFAFLVTICYAGN. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title