missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ CKLFSF5 Recombinant Protein

Name: Abnova&trade; CKLFSF5 Recombinant Protein
Brand: Abnova&trade;
SKU: 16107323
Price: 528.00 EUR

Brand: Abnova™ H00116173-P01.25ug

Additional Details : Weight : 0.00010kg

Product Code. 16107323

Quantity
Estimated Shipment: 07-07-2023
to see stock.

Add to basket

Description

ELISA, Western Blotting (Recombinant Protein), Antibody Production, Protein Array

Specifications

Accession Number	AAH13109
Format	Solution
Gene ID (Entrez)	116173
Name	CKLFSF5 (Human) Recombinant Protein (P01)
Preparation Method	In vitro wheat germ expression system
Quality Control Testing	12.5% SDS-PAGE Stained with Coomassie Blue.
Source	Wheat Germ (in vitro)
Storage Requirements	Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Common Name	CMTM5
Cross Reactivity	Human
Recombinant	Yes

For Use With (Application)	Antibody Production, Array, Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein)
Formulation	50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer
Molecular Weight (g/mol)	43.3
pH Range	8
Purification Method	Glutathione Sepharose 4 Fast Flow
Quantity	25 ug
Immunogen	MLSARDRRDRHPEEGVVAELQGFAVDKAFLTSHKGILLETELALTLIIFICFTASISAYMAAALLEFFITLAFLFLYATQYYQRFDRINWPCLDFLRCVSAIIIFLVVSFAAVTSRDGAAIAAFVFGIILVSIFAYDAFKIYRTEMAPGASQGDQQ
Gene Alias	CKLFSF5/FLJ37521
Gene Symbol	CMTM5
Host Species	Wheat Germ (in vitro)
Protein Tag	GST

Description