missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ CIRBP (Human) Recombinant Protein

Human CIRBP full-length ORF ( AAH00403, 1 a.a. - 172 a.a.) recombinant protein with GST-tag at N-terminal.

Brand: Abnova™ H00001153-P02.25ug

Product Code. 16193221

Quantity

Estimated Shipment: 13-11-2024
to see stock.

Add to basket

This item is not returnable. View return policy

Description

Sequence: MASDEGKLFVGGLSFDTNEQSLEQVFSKYGQISEVVVVKDRETQRSRGFGFVTFENIDDAKDAMMAMNGKSVDGRQIRVDQAGKSSDNRSRGYRGGSAGGRGFFRGGRGRGRGFSRGGGDRGYGGNRFESRSGGYGGSRDYYSSRSQSGGYSDRSSGGSYRDSYDSYATHNE

Specifications

Accession Number	AAH00403
Name	cold inducible RNA binding protein
Quality Control Testing	125% SDS-PAGE Stained with Coomassie Blue
Storage Requirements	Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Gene Symbol	CIRBP
Protein Tag	GST

Gene ID (Entrez)	1153
Preparation Method	Wheat germ expression system
Quantity	25 μg
Gene Alias	CIRP
Species	Wheat Germ (in vitro)
Buffer	50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer

Product Suggestions

Description