missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ CEACAM8 (Human) Recombinant Protein

Human CEACAM8 full-length ORF ( AAH26263, 1 a.a. - 349 a.a.) recombinant protein with GST-tag at N-terminal.

335.00€ - 508.00€

Accession Number	AAH26263
Gene ID (Entrez)	1088
Name	carcinoembryonic antigen-related cell adhesion molecule 8
Preparation Method	Wheat germ expression system
Quality Control Testing	125% SDS-PAGE Stained with Coomassie Blue

View More Specs

Products 2

Product Code	Brand	Quantity	Price	Quantity & Availability
Product Code	Brand	Quantity	Price	Quantity & Availability
16106244 View Documents Promotion Details missing translation for 'viewProductCertificates'	Abnova™ H00001088-P01.10UG	10 μg	335.00€ 10µg View alternative products Save Up to »	Estimated Shipment: 05-06-2024 Log in to see stock.	Add to basket

16116244 View Documents Promotion Details missing translation for 'viewProductCertificates'	Abnova™ H00001088-P01.25UG	25 μg	508.00€ 25µg View alternative products Save Up to »	Estimated Shipment: 05-06-2024 Log in to see stock.	Add to basket

Description

Sequence: MGPISAPSCRWRIPWQGLLLTASLFTFWNPPTTAQLTIEAVPSNAAEGKEVLLLVHNLPQDPRGYNWYKGETVDANRRIIGYVISNQQITPGPAYSNRETIYPNASLLMRNVTRNDTGSYTLQVIKLNLMSEEVTGQFSVHPETPKPSISSNNSNPVEDKDAVAFTCEPETQNTTYLWWVNGQSLPVSPRLQLSNGNRTLTLLSVTRNDVGPYECEIQNPASANFSDPVTLNVLYGPDAPTISPSDTYYHAGVNLNLSCHAASNPPSQYSWSVNGTFQQYTQKLFIPNITTKNSGSYACHTTNSATGRNRTTVRMITVSDALVQGSSPGLSARATVSIMIGVLARVALI

Specifications

Accession Number	AAH26263
Name	carcinoembryonic antigen-related cell adhesion molecule 8
Quality Control Testing	125% SDS-PAGE Stained with Coomassie Blue
Gene Alias	CD66b, CD67, CGM6, NCA-95
Species	Wheat Germ (in vitro)
Buffer	50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer

Gene ID (Entrez)	1088
Preparation Method	Wheat germ expression system
Storage Requirements	Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Gene Symbol	CEACAM8
Protein Tag	GST

Description