missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ CDKN2B (Human) Recombinant Protein
Human CDKN2B full-length ORF ( AAH14469, 1 a.a. - 138 a.a.) recombinant protein with GST-tag at N-terminal.
Brand: Abnova™ H00001030-P01.25ug
Additional Details : Weight : 0.00010kg
Description
- Sequence: MREENKGIPSGGGSDEGLASAAARGLVEKVRQLLEAGADPNGVNRFGRRAIQVMMMGSARVAELLLLHGAEPNCADPATLTRPVHDAAREGFLDTLVVLHRAGARLDVRDAWGRLPVDLAEERGHRDVAGYLRTATGD
Specifications
| AAH14469 | |
| cyclin-dependent kinase inhibitor 2B (p15, inhibits CDK4) | |
| 125% SDS-PAGE Stained with Coomassie Blue | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| CDKN2B | |
| GST |
| 1030 | |
| Wheat germ expression system | |
| 25 μg | |
| CDK4I, INK4B, MTS2, P15, TP15, p15INK4b | |
| Wheat Germ (in vitro) | |
| 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer |