missing translation for 'onlineSavingsMsg'
Learn More
Learn More
CDKL4 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
415.00€ - 624.00€
Specifications
| Antigen | CDKL4 |
|---|---|
| Dilution | Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200 |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18683116
|
Novus Biologicals
NBP2-39090-25ul |
25 μL |
415.00€
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18168118
|
Novus Biologicals
NBP2-39090 |
0.1 mL |
624.00€
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Beschreibung
CDKL4 Polyclonal specifically detects CDKL4 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Spezifikation
| CDKL4 | |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| Human | |
| Q5MAI5 | |
| 344387 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: FHGISIPEPEDMETLEEKFSDVHPVALNFMKGCLKMNPDDRLTCSQLLESSYFDS | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| Polyclonal | |
| Rabbit | |
| Protein Kinase | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| cyclin-dependent kinase-like 4, EC 2.7.11, EC 2.7.11.22 | |
| CDKL4 | |
| IgG | |
| Affinity Purified |
Haben Sie Verbesserungsvorschläge?Übermitteln Sie eine inhaltliche Korrektur
Berichtigung von Produktinhalten
Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.
Name des Produkts