missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Cdk5 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
302.00€ - 498.00€
Specifications
| Antigen | Cdk5 |
|---|---|
| Applications | Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18230733
|
Novus Biologicals
NBP2-55870 |
100 μL |
498.00€
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18675597
|
Novus Biologicals
NBP2-55870-25ul |
25 μL |
302.00€
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
Cdk5 Polyclonal specifically detects Cdk5 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
| Cdk5 | |
| Polyclonal | |
| Rabbit | |
| Cell Cycle and Replication | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| 1020 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:TEEQWPSMTKLPDYKPYPMYPATTSLVNVVPKLNATGRDLLQNLLKCNPVQRISAEEALQHPYFSDFCP | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| Human | |
| Cell division protein kinase 5, cyclin-dependent kinase 5, EC 2.7.11, EC 2.7.11.22, protein kinase CDK5 splicing, PSSALRE, Serine/threonine-protein kinase PSSALRE, Tau protein kinase II catalytic subunit, TPKII catalytic subunit | |
| CDK5 | |
| IgG | |
| Affinity Purified |
For Research Use Only
Vous avez repéré une opportunité d'amélioration ?Partager une correction de contenu
Correction du contenu d'un produit
Veuillez fournir vos retours sur le contenu du produit en remplissant le formulaire ci-dessous.
Nom du produit