missing translation for 'onlineSavingsMsg'
Learn More

Cdc23 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand: Novus Biologicals NBP3-35501-100ul

View more versions of this product

Product Code. 30231906

550.00€ / 100µL

Please sign in to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Cdc23 Polyclonal antibody specifically detects Cdc23 in Human,Mouse,Rat samples. It is validated for ELISA,Immunohistochemistry,Western Blot,Immunohistochemistry (Paraffin)

Specifications

Antigen	Cdc23
Classification	Polyclonal
Dilution	Western Blot 1:500 - 1:2000, ELISA, Immunohistochemistry, Immunohistochemistry-Paraffin 1:100 - 1:200
Gene Alias	ANAPC8anaphase promoting complex subunit 8, Anaphase-promoting complex subunit 8, APC8CDC23 (cell division cycle 23, yeast, homolog), cell division cycle 23 homolog (S. cerevisiae), cell division cycle protein 23 homolog, CUT23, Cyclosome subunit 8
Immunogen	A synthetic peptide corresponding to a sequence within amino acids 50-150 of human Cdc23 (NP_004652.2).,, Sequence:, HSSKWSAELAFSLPALPLAELQPPPPITEEDAQDMDAYTLAKAYFDVKEYDRAAHFLHGCNSKKAYFLYMYSRYLSGEKKKDDETVDSLGPLEKGQVKNEA
Quantity	100 μL
Research Discipline	Cell Cycle and Replication
Gene ID (Entrez)	8697
Content And Storage	Store at -20°C. Avoid freeze-thaw cycles.
Isotype	IgG

Applications	ELISA, Immunohistochemistry, Western Blot, Immunohistochemistry (Paraffin)
Conjugate	Unconjugated
Formulation	PBS (pH 7.3), 50% glycerol
Host Species	Rabbit
Purification Method	Affinity purified
Regulatory Status	RUO
Primary or Secondary	Primary
Target Species	Human, Mouse, Rat
Form	Purified

Produktvorschläge

Berichtigung von Produktinhalten

Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.

Name des Produkts

Ihr Name

E-Mail Adresse *

Art der Problems *

Detaillierte Beschreibung des Problems/der Anfrage *

Indem Sie auf Absenden klicken, erklären Sie sich damit einverstanden, dass Fisher Scientific sich mit Ihnen in Verbindung setzen kann, um Ihr Feedback in diesem Formular zu bearbeiten. Wir werden Ihre Informationen nicht für andere Zwecke weitergeben. Alle bereitgestellten Kontaktinformationen werden in Übereinstimmung mit unserer Datenschutzrichtlinie aufbewahrt. Datenschutzrichtlinie.

Abbrechen Absenden

Vielen Dank, dass Sie uns helfen, unsere Website zu verbessern. Ihr Feedback wurde übermittelt

Haben Sie Verbesserungsvorschläge?Übermitteln Sie eine inhaltliche Korrektur

Cdc23 Antibody, Novus Biologicals™

Description

Specifications

Produktvorschläge

Dokumentation

Aktionen