missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ CD40 (Human) Recombinant Protein
Human CD40 full-length ORF ( NP_001241, 1 a.a. - 277 a.a.) recombinant protein with GST-tag at N-terminal.
Brand: Abnova™ H00000958-P02.25ug
Additional Details : Weight : 0.00010kg
Description
- Sequence: MVRLPLQCVLWGCLLTAVHPEPPTACREKQYLINSQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCVLHRSCSPGFGVKQIATGVSDTICEPCPVGFFSNVSSAFEKCHPWTSCETKDLVVQQAGTNKTDVVCGPQDRLRALVVIPIIFGILFAILLVLVFIKKVAKKPTNKAPHPKQEPQEINFPDDLPGSNTAAPVQETLHGCQPVTQEDGKESRISVQERQ
Specifications
| NP_001241 | |
| CD40 molecule, TNF receptor superfamily member 5 | |
| 125% SDS-PAGE Stained with Coomassie Blue | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| CD40 | |
| GST |
| 958 | |
| Wheat germ expression system | |
| 25 μg | |
| Bp50, CDW40, MGC9013, TNFRSF5, p50 | |
| Wheat Germ (in vitro) | |
| 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer |