missing translation for 'onlineSavingsMsg'
Learn More
Learn More
CD3 gamma Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
285.00€ - 539.00€
Specifications
| Antigen | CD3 gamma |
|---|---|
| Dilution | Western Blot 0.4 ug/ml, Simple Western 1:25, Immunohistochemistry, Immunohistochemistry-Paraffin 1:200 - 1:500 |
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18412792
|
Novus Biologicals
NBP2-32636-25ul |
25 μL |
285.00€
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18102224
|
Novus Biologicals
NBP2-32636 |
0.1 mL |
539.00€
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
CD3 gamma Polyclonal specifically detects CD3 gamma in Human samples. It is validated for Western Blot, Simple Western, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| CD3 gamma | |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| Human | |
| CD3g antigen, CD3g antigen, gamma polypeptide (TiT3 complex), CD3g molecule, epsilon (CD3-TCR complex), CD3g molecule, gamma (CD3-TCR complex), CD3-GAMMA, FLJ17620, FLJ17664, FLJ79544, FLJ94613, MGC138597, T3G, T-cell antigen receptor complex, gamma subunit of T3, T-cell receptor T3 gamma chain, T-cell surface glycoprotein CD3 gamma chain | |
| CD3G | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Western Blot 0.4 ug/ml, Simple Western 1:25, Immunohistochemistry, Immunohistochemistry-Paraffin 1:200 - 1:500 | |
| Polyclonal | |
| Rabbit | |
| Apoptosis, Innate Immunity | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 917 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: GQDGVRQSRASDKQTLLPNDQLYQPLKDREDDQYSHLQGNQLRRN | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title