missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Catenin alpha 2 Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
193.00€ - 463.00€
Specifications
| Antigen | Catenin alpha 2 |
|---|---|
| Dilution | Western Blot 1:500 - 1:1000, Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/ Immunofluorescence 1:50 - 1:200, Immunohistochemistry-Paraffin |
| Applications | Western Blot, Immunohistochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18643732
|
Novus Biologicals
NBP2-92753-0.02ml |
0.02 mL |
193.00€
0.02mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18621082
|
Novus Biologicals
NBP2-92753-0.1ml |
0.1 mL |
463.00€
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
Catenin alpha 2 Polyclonal antibody specifically detects Catenin alpha 2 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry (Paraffin)Specifications
| Catenin alpha 2 | |
| Western Blot, Immunohistochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| Rabbit | |
| Cellular Markers | |
| PBS with 50% glycerol, pH7.3. | |
| 1496 | |
| IgG | |
| Affinity purified |
| Western Blot 1:500 - 1:1000, Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/ Immunofluorescence 1:50 - 1:200, Immunohistochemistry-Paraffin | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human, Mouse, Rat | |
| Alpha-catenin-related protein, cancer/testis antigen 114, CAPRrelated, catenin (cadherin-associated protein), alpha 2, catenin alpha-2, CTNR, DKFZp686H02198 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 167-290 of human Catenin alpha 2 (NP_001269526.1). TNEQDLANRFKEFGKEMVKLNYVAARRQQELKDPHCRDEMAAARGALKKNATMLYTASQAFLRHPDVAATRANRDYVFKQVQEAIAGISNAAQATSPTDEAKGHTGIGELAAALNEFDNKIILD | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title