missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Catalase Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
294.00€ - 510.00€
Specifications
| Antigen | Catalase |
|---|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18654026
|
Novus Biologicals
NBP2-38646-25ul |
25 μL |
294.00€
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18197008
|
Novus Biologicals
NBP2-38646 |
0.1 mL |
510.00€
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
Catalase Polyclonal specifically detects Catalase in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| Catalase | |
| Polyclonal | |
| Rabbit | |
| Cancer, Cellular Markers, Hypoxia, Lipid and Metabolism, Neuroscience, Peroxisome Markers, Signal Transduction | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| catalase, EC 1.11.1.6, MGC138422, MGC138424 | |
| CAT | |
| IgG | |
| Affinity Purified |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| Human | |
| P04040 | |
| 847 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: ADSRDPASDQMQHWKEQRAAQKADVLTTGAGNPVGDKLNVITVGPRGPLLVQDVVFTDEMAHFDRERIPERVVHAKGAGAFGYFE | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title