missing translation for 'onlineSavingsMsg'
Learn More
Learn More
CAT1 Antibody (2B9), Novus Biologicals™
Mouse Monoclonal Antibody
Brand: Novus Biologicals H00006541-M02
This item is not returnable.
View return policy
Description
CAT1 Monoclonal antibody specifically detects CAT1 in Human, Mouse samples. It is validated for Western Blot, ELISA, ELISA
Specifications
| CAT1 | |
| Monoclonal | |
| Unconjugated | |
| NP_003036 | |
| Mouse | |
| Protein A purified | |
| RUO | |
| 6541 | |
| Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles. | |
| IgG1 κ |
| Western Blot, ELISA, Sandwich ELISA | |
| 2B9 | |
| In 1x PBS, pH 7.4 | |
| amino acid transporter, cationic 1, ATRC1ERR, CAT-1System Y+ basic amino acid transporter, Ecotropic retroviral leukemia receptor homolog, ecotropic retroviral receptor, Ecotropic retrovirus receptor homolog, HCAT1, high affinity cationic amino acid transporter 1, REC1LCAT1, solute carrier family 7 (cationic amino acid transporter, y+ system), member 1, Solute carrier family 7 member 1 | |
| SLC7A1 (NP_003036, 431 a.a. ~ 492 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. RYQPEQPNLVYQMASTSDELDPADQNELASTNDSQLGFLPEAEMFSLKTILSPKNMEPSKIS | |
| 0.1 mg | |
| Primary | |
| Human, Mouse | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction