missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Cardiotrophin-1/CT-1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
477.00€
Specifications
| Antigen | Cardiotrophin-1/CT-1 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
Cardiotrophin-1/CT-1 Polyclonal specifically detects Cardiotrophin-1/CT-1 in Human samples. It is validated for Western Blot.Specifications
| Cardiotrophin-1/CT-1 | |
| Polyclonal | |
| Rabbit | |
| Cell Cycle and Replication, Protein Kinase | |
| cardiophin 1, cardiotrophin 1, cardiotrophin-1, CT-1CT1 | |
| CTF1 | |
| IgG | |
| 21 kDa |
| Western Blot | |
| Unconjugated | |
| RUO | |
| NP_001321 | |
| 1489 | |
| Synthetic peptide directed towards the N terminal of human CTF1. Peptide sequence HSLAHLLTKYAEQLLQEYVQLQGDPFGLPSFSPPRLPVAGLSAPAPSHAG. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title