missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Carbonic Anhydrase VIII/CA8 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
484.00€
Specifications
| Antigen | Carbonic Anhydrase VIII/CA8 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Form | Purified |
Description
Carbonic Anhydrase VIII/CA8 Polyclonal specifically detects Carbonic Anhydrase VIII/CA8 in Human samples. It is validated for Western Blot.Specifications
| Carbonic Anhydrase VIII/CA8 | |
| Polyclonal | |
| Purified | |
| RUO | |
| P35219 | |
| 767 | |
| Synthetic peptides corresponding to CA8(carbonic anhydrase VIII) The peptide sequence was selected from the N terminal of CA8. Peptide sequence YEEGVEWGLVFPDANGEYQSPINLNSREARYDPSLLDVRLSPNYVVCRDC. | |
| Primary | |
| 32 kDa |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| Lipid and Metabolism | |
| CALScarbonate dehydratase, CAMRQ3, carbonic anhydrase VIIIMGC99509, carbonic anhydrase-like sequence, carbonic anhydrase-related protein, CARPCA-related protein, CA-VIII, MGC120502 | |
| CA8 | |
| IgG | |
| Protein A purified |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title