missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Carbonic Anhydrase VA/CA5A Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
483.00€
Specifications
| Antigen | Carbonic Anhydrase VA/CA5A |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
Carbonic Anhydrase VA/CA5A Polyclonal specifically detects Carbonic Anhydrase VA/CA5A in Human samples. It is validated for Western Blot.Specifications
| Carbonic Anhydrase VA/CA5A | |
| Polyclonal | |
| Rabbit | |
| Lipid and Metabolism | |
| P35218 | |
| 763 | |
| Synthetic peptides corresponding to CA5A (carbonic anhydrase VA, mitochondrial) The peptide sequence was selected from the C terminal of CA5A. Peptide sequence PSQLSAFRTLLFSALGEEEKMMVNNYRPLQPLMNRKVWASFQATNEGTRS. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Human | |
| CA5carbonic anhydrase 5A, mitochondrial, Carbonate dehydratase VA, carbonic anhydrase V, mitochondrial, Carbonic anhydrase VA, carbonic anhydrase VA, mitochondrial, carbonic dehydratase, CAV, CAVA, CA-VA, EC 4.2.1.1 | |
| CA5A | |
| IgG | |
| 34 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title