missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Carbonic Anhydrase IX/CA9 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
302.00€ - 500.00€
Specifications
| Antigen | Carbonic Anhydrase IX/CA9 |
|---|---|
| Dilution | Immunohistochemistry-Paraffin 1:500 - 1:1000 |
| Applications | Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18198619
|
Novus Biologicals
NBP2-54743 |
100 μL |
500.00€
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18629498
|
Novus Biologicals
NBP2-54743-25ul |
25 μL |
302.00€
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
Carbonic Anhydrase IX/CA9 Polyclonal specifically detects Carbonic Anhydrase IX/CA9 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| Carbonic Anhydrase IX/CA9 | |
| Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| Human | |
| CA-IX, CAIXcarbonic anhydrase 9, Carbonate dehydratase IX, carbonic anhydrase IXpMW1, carbonic dehydratase, EC 4.2.1.1, G250, Membrane antigen MN, MNRCC-associated antigen G250, P54/58N, RCC-associated protein G250, Renal cell carcinoma-associated antigen G250 | |
| CA9 | |
| IgG | |
| Affinity Purified |
| Immunohistochemistry-Paraffin 1:500 - 1:1000 | |
| Polyclonal | |
| Rabbit | |
| Cancer, Cellular Markers, HIF Target Genes, Hypoxia, Lipid and Metabolism, Signal Transduction, Vision | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| 768 | |
| This antibody was developed against a Recombinant Protein corresponding to amino acids:PCAQGVIWTVFNQTVMLSAKQLHTLSDTLWGPGDSRLQLNFRATQPLNGRVIEASFPAGVDSSPRAAEPVQLNSCL | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title