missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ CALR (Human) Recombinant Protein

Human CALR full-length ORF ( AAH02500.1, 1 a.a. - 417 a.a.) recombinant protein with GST-tag at N-terminal.

Brand: Abnova™ H00000811-P01.25ug

Product Code. 16192541

Quantity

Estimated Shipment: 23-10-2024
to see stock.

Add to basket

This item is not returnable. View return policy

Description

Sequence: MLLSVPLLLGLLGLAVAEPAVYFKEQFLDGDGWTSRWIESKHKSDFGKFVLSSGKFYGDEEKDKGLQTSQDARFYALSASFEPFSNKGQTLVVQFTVKHEQNIDCGGGYVKLFPNSLDQTDMHGDSEYNIMFGPDICGPGTKKVHVIFNYKGKNVLINKDIRCKDDEFTHLYTLIVRPDNTYEVKIDNSQVESGSLEDDWDFLPPKKIKDPDASKPEDWDERAKIDDPTDSKPEDWDKPEHIPDPDAKKPEDWDEEMDGEWEPPVIQNPEYKGEWKPRQIDNPDYKGTWIHPEIDNPEYSPDPSIYAYDNFGVLGLDLWQVKSGTIFDNFLITNDEAYAEEFGNETWGVTKAAEKQMKDKQDEEQRLKEEEEDKKRKEEEEAEDKEDDEDKDEDEEDEEDKEEDEEEDVPGQAKDEL

Specifications

Accession Number	AAH02500.1
Name	calreticulin
Quality Control Testing	125% SDS-PAGE Stained with Coomassie Blue
Storage Requirements	Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Gene Symbol	CALR
Protein Tag	GST

Gene ID (Entrez)	811
Preparation Method	Wheat germ expression system
Quantity	25 μg
Gene Alias	CRT, FLJ26680, RO, SSA, cC1qR
Species	Wheat Germ (in vitro)
Buffer	50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer

Product Suggestions

Description