missing translation for 'onlineSavingsMsg'
Learn More
Learn More
CADPS Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
190.00€ - 550.00€
Specifications
| Antigen | CADPS |
|---|---|
| Dilution | Western Blot 1:1000 - 1:2000, ELISA |
| Applications | ELISA, Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
30229471
|
Novus Biologicals
NBP3-35322-20ul |
20 μL |
190.00€
20µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
30231810
|
Novus Biologicals
NBP3-35322-100ul |
100 μL |
550.00€
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
CADPS Polyclonal antibody specifically detects CADPS in Mouse,Rat samples. It is validated for ELISA,Western BlotSpecifications
| CADPS | |
| ELISA, Western Blot | |
| Unconjugated | |
| Rabbit | |
| Neuroscience, Signal Transduction | |
| PBS (pH 7.3), 50% glycerol | |
| 8618 | |
| IgG | |
| Affinity purified |
| Western Blot 1:1000 - 1:2000, ELISA | |
| Polyclonal | |
| Purified | |
| RUO | |
| Mouse, Rat | |
| Ca++-dependent secretion activator, CADPS1, Calcium-dependent activator protein for secretion 1, calcium-dependent secretion activator 1, CAPS-1, CAPS1Ca2+-dependent secretion activator, CAPSCa2+-dependent activator protein for secretion, KIAA1121Ca2+-regulated cytoskeletal protein | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 1020-1100 of human CADPS (NP_899630.1).,, Sequence:, MASDMIESCVKRTRIAFEVKLQKTSRSTDFRVPQSICTMFNVMVDAKAQSTKLCSMEMGQEHQYHSKIDELIEETVKEMIT | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title