missing translation for 'onlineSavingsMsg'
Learn More
Learn More
CABYR Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
415.00€ - 624.00€
Specifications
| Antigen | CABYR |
|---|---|
| Dilution | Western Blot 0.4 ug/ml, Immunohistochemistry 1:500 - 1:1000, Immunocytochemistry/Immunofluorescence 1-4 ug/ml, Immunohistochemistry-Paraffin 1:500 - 1:1000 |
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Code produit | Marque | Quantity | Prix | Quantité et disponibilité | |||||
|---|---|---|---|---|---|---|---|---|---|
| Code produit | Marque | Quantity | Prix | Quantité et disponibilité | |||||
|
18461761
|
Novus Biologicals
NBP2-14430-25ul |
25ul |
415.00€
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18110682
|
Novus Biologicals
NBP2-14430 |
0.1 mL |
624.00€
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
CABYR Polyclonal specifically detects CABYR in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Spécification
| CABYR | |
| Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| Human | |
| CABYRa, CABYRc, calcium binding tyrosine-(Y)-phosphorylation regulated, Calcium-binding protein 86, calcium-binding tyrosine-(Y)-phosphorylation regulated (fibrousheathin 2), Cancer/testis antigen 88, CBP86CABYRc/d, CT88MGC9117, fibrousheathin 2, Fibrousheathin II, fibrousheathin-2, FSP-2calcium binding tyrosine-(Y)-phosphorylation regulated (fibrousheathin 2), FSP2calcium-binding tyrosine phosphorylation-regulated protein, Testis-specific calcium-binding protein CBP86 | |
| CABYR | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Western Blot 0.4 ug/ml, Immunohistochemistry 1:500 - 1:1000, Immunocytochemistry/Immunofluorescence 1-4 ug/ml, Immunohistochemistry-Paraffin 1:500 - 1:1000 | |
| Polyclonal | |
| Rabbit | |
| Signal Transduction | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 26256 | |
| This antibody was developed against a recombinant protein corresponding to the amino acids: YNDVPVTEGVVYIEQLPEQIVIPFTDQVACLKENEQSKENEQSPRVSPKSVVEKTTSGMSKKSVESVKLAQLEENAKYSSVYMEAEATALLSD | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
For Research Use Only
Vous avez repéré une opportunité d'amélioration ?Partager une correction de contenu
Correction du contenu d'un produit
Veuillez fournir vos retours sur le contenu du produit en remplissant le formulaire ci-dessous.
Nom du produit