missing translation for 'onlineSavingsMsg'
Learn More
Learn More
c-Myc-responsive protein Rcl Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
409.50€ - 540.75€
Specifications
| Antigen | c-Myc-responsive protein Rcl |
|---|---|
| Dilution | Western Blot 0.4 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin 1:10-1:20 |
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18466621
|
Novus Biologicals
NBP1-85181-25ul |
25ul |
433.00€ 409.50€ / 25µL Save 23.50€ 5% Off |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18245368
|
Novus Biologicals
NBP1-85181 |
0.1 mL |
572.00€ 540.75€ / 0.10mL Save 31.25€ 5% Off |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
c-Myc-responsive protein Rcl Polyclonal specifically detects c-Myc-responsive protein Rcl in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| c-Myc-responsive protein Rcl | |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 10591 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:MAAAMVPGRSESWERGEPGRPALYFCGSIRGGREDRTLYERIVSRLRRFGTVLTEHV | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Western Blot 0.4 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin 1:10-1:20 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| chromosome 6 open reading frame 108, c-Myc-responsive protein Rcl, deoxyribonucleoside 5'-monophosphate N-glycosidase, dJ330M21.3, EC 3.2.2, EC 3.2.2.-, putative c-Myc-responsive, rcl, RP3-330M21.3 | |
| DNPH1 | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title