missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ BTG1 (Human) Recombinant Protein

Human BTG1 full-length ORF ( AAH16759, 1 a.a. - 171 a.a.) recombinant protein with GST-tag at N-terminal.

Brand: Abnova™ H00000694-P01.10ug

Product Code. 16192371

Quantity

Estimated Shipment: 20-11-2024
to see stock.

Add to basket

This item is not returnable. View return policy

Description

Sequence: MHPFYTRAATMIGEIAAAVSFISKFLRTKGLTSERQLQTFSQSLQELLAEHYKHHWFPEKPCKGSGYRCIRINHKMDPLIGQAAQRIGLSSQELFRLLPSELTLWVDPYEVSYRIGEDGSICVLYEASPAGGSTQNSTNVQMVDSRISCKEELLLGRTSPSKNYNMMTVSG

Specifications

Accession Number	AAH16759
Name	B-cell translocation gene 1, anti-proliferative
Quality Control Testing	125% SDS-PAGE Stained with Coomassie Blue
Storage Requirements	Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Species	Wheat Germ (in vitro)
Buffer	50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer

Gene ID (Entrez)	694
Preparation Method	Wheat germ expression system
Quantity	10 μg
Gene Symbol	BTG1
Protein Tag	GST

Product Suggestions

Description