missing translation for 'onlineSavingsMsg'
Learn More
Learn More
BNC1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
280.00€ - 556.50€
Specifications
| Antigen | BNC1 |
|---|---|
| Applications | Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18263084
|
Novus Biologicals
NBP2-55855 |
100 μL |
 589.00€ 556.50€ / 100µL Save 32.50€ 5% Off |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18639486
|
Novus Biologicals
NBP2-55855-25ul |
25 μL |
280.00€
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
BNC1 Polyclonal specifically detects BNC1 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
| BNC1 | |
| Polyclonal | |
| Rabbit | |
| Cell Cycle and Replication | |
| basonuclin, basonuclin 1, BNC, BSN1, HsT19447, zinc finger protein basonuclin, zinc finger protein basonuclin-1 | |
| BNC1 | |
| IgG | |
| Affinity Purified |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| Human | |
| 646 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:LSQEALESSEDHFRAAYLLKDVAKEAYQDVAFTQQASQTSVIFKGTSRMGSLVYPITQVHSASLESYNSGPLSEGTILDLSTTSSMKS | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Individuate un'opportunità di miglioramento?Condividi una correzione di contenuto
Correzione del contenuto del prodotto
Fornite il vostro feedback sul contenuto del prodotto compilando il modulo sottostante.
Titolo del prodotto