missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ BGN (Human) Recombinant Protein

Name: Abnova&trade; BGN (Human) Recombinant Protein
Brand: Abnova&trade;
SKU: 16102231
Price: 335.00 EUR

Human BGN full-length ORF ( AAH02416.1, 1 a.a. - 368 a.a.) recombinant protein with GST-tag at N-terminal.

Brand: Abnova™ H00000633-P01.10ug

Additional Details : Weight : 0.00010kg

Product Code. 16102231

Quantity

Estimated Shipment: 31-05-2024
to see stock.

Add to basket

Description

Sequence: MWPLWRLVSLLALSQALPFEQRGFWDFTLDDGPFMMNDEEASGADTSGVLDPDSVTPTYSAMCPFGCHCHLRVVQCSDLGLKSVPKEISPDTTLLDLQNNDISELRKDDFKGLQHLYALVLVNNKISKIHEKAFSPLRKLQKLYISKNHLVEIPPNLPSSLVELRIHDNRIRKVPKGVFSGLRNMNCIEMGGNPLENSGFEPGAFDGLKLNYLRISEAKLTGIPKDLPETLNELHLDHNKIQAIELEDLLRYSKLYRLGLGHNQIRMIENGSLSFLPTLRELHLDNNKLARVPSGLPDLKLLQVVYLHSNNITKVGVNDFCPMGFGVKRAYYNGISLFNNPVPYWEVQPATFRCVTDRLAIQFGNYKK

Specifications

Accession Number	AAH02416.1
Name	biglycan
Quality Control Testing	125% SDS-PAGE Stained with Coomassie Blue
Storage Requirements	Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Gene Symbol	BGN
Protein Tag	GST

Gene ID (Entrez)	633
Preparation Method	Wheat germ expression system
Quantity	10 μg
Gene Alias	DSPG1, PG-S1, PGI, SLRR1A
Species	Wheat Germ (in vitro)
Buffer	50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer

Product Suggestions

Description