missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ BCL2L2 (Human) Recombinant Protein

Name: Abnova&trade; BCL2L2 (Human) Recombinant Protein
Brand: Abnova&trade;
SKU: 16102181
Price: 508.00 EUR

Human BCL2L2 full-length ORF ( NP_004041.1, 1 a.a. - 193 a.a.) recombinant protein with GST-tag at N-terminal.

Brand: Abnova™ H00000599-P01.25ug

Additional Details : Weight : 0.00010kg

Product Code. 16102181

Quantity

Estimated Shipment: 06-06-2024
to see stock.

Add to basket

Description

Sequence: MATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIHSSGGWAEFTALYGDGALEEARRLREGNWASVRTVLTGAVALGALVTVGAFFASK

Specifications

Accession Number	NP_004041.1
Name	BCL2-like 2
Quality Control Testing	125% SDS-PAGE Stained with Coomassie Blue
Storage Requirements	Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Gene Symbol	BCL2L2
Protein Tag	GST

Gene ID (Entrez)	599
Preparation Method	Wheat germ expression system
Quantity	25 μg
Gene Alias	BCL-W, BCLW, KIAA0271
Species	Wheat Germ (in vitro)
Buffer	50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer

Product Suggestions

Description