missing translation for 'onlineSavingsMsg'
Learn More
Learn More
bcl10-interacting CARD protein Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-92715-0.02ml
This item is not returnable.
View return policy
Description
bcl10-interacting CARD protein Polyclonal antibody specifically detects bcl10-interacting CARD protein in Human, Mouse samples. It is validated for Western Blot
Specifications
| bcl10-interacting CARD protein | |
| Polyclonal | |
| Western Blot 1:500-1:2000 | |
| bA370F5.1, bcl10-interacting CARD protein, Bcl10-interacting protein with CARD, BinCARD, chromosome 9 open reading frame 89, MGC110898, MGC11115 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human CARD19 (NP_115686.3). MTDQTYCDRLVQDTPFLTGHGRLSEQQVDRIILQLNRYYPQILTNKEAEKFRNPKASLRVRLCDLLSHLQRSGERDCQEFYRALYIHAQPLHSRLPSRHA | |
| 0.02 mL | |
| Protein Kinase | |
| 84270 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot | |
| Unconjugated | |
| PBS with 50% glycerol, pH7.3. | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human, Mouse | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction