missing translation for 'onlineSavingsMsg'
Learn More
Learn More
BAD-LAMP/LAMP5 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
484.00€
Specifications
| Antigen | BAD-LAMP/LAMP5 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
BAD-LAMP/LAMP5 Polyclonal specifically detects BAD-LAMP/LAMP5 in Human samples. It is validated for Western Blot.Specifications
| BAD-LAMP/LAMP5 | |
| Polyclonal | |
| Rabbit | |
| Q9UJQ1 | |
| 24141 | |
| Synthetic peptides corresponding to C20ORF103 The peptide sequence was selected from the middle region of C20ORF103. Peptide sequence CQAQQTISLASSDPQKTVTMILSAVHIQPFDIISDFVFSEEHKCPVDERE. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| BADLAMP, C20orf103, chromosome 20 open reading frame 103, dJ1119D9.3, LAMP family protein C20orf103, LAMP5, LAMP-5, lysosomal-associated membrane protein family, member 5, UNC-43 | |
| LAMP5 | |
| IgG | |
| 28 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title