missing translation for 'onlineSavingsMsg'
Learn More

B4GALNT2 Antibody, Novus Biologicals™

Product Code. 18044104 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mL
Unit Size:
0.1mL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18044104 0.1 mL 0.1mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18044104 Supplier Novus Biologicals Supplier No. NBP191229

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Rabbit Polyclonal Antibody has been used in 4 publications

B4GALNT2 Polyclonal specifically detects B4GALNT2 in Human, Mouse, Rhesus Macaque samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin, Immunohistochemistry-Frozen.
TRUSTED_SUSTAINABILITY

Specifications

Antigen B4GALNT2
Applications Immunohistochemistry, Immunohistochemistry (Paraffin), Immunohistochemistry (Frozen)
Classification Polyclonal
Conjugate Unconjugated
Dilution Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200, Immunohistochemistry-Frozen
Formulation PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias 4 GalNAcT/Sda-GalNAcT, B4GALT, beta 1,4 N-acetylgalactosaminyltransferase/betal, beta-1,4 N-acetylgalactosaminyltransferase 2, beta-1,4-N-acetyl-galactosaminyl transferase 2, beta-4-N-acetylgalactosaminyltransferase, GALGT2, MGC142235, MGC142237, sd(a) beta-1,4-GalNAc transferase, sda beta-1,4-GalNAc transferase, UDP-GalNAc:Neu5Aca2-3Galb-R b1,4-N-acetylgalactosaminyltransferase
Gene Symbols B4GALNT2
Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:LLPEERLRNLFSYDGIWLFPKNQCKCEANKEQGGYNFQDAYGQSDLPAVKARRQAEFEHFQRREGLPRPLPLLVQPNLPFGYPVHGVEVMPLHTVPIPGLQFEGPDA
Purification Method Affinity Purified
Quantity 0.1 mL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 124872
Test Specificity Specificity of human B4GALNT2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human, Mouse, Rhesus Macaque
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.