missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ATPAF1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
415.00€ - 572.00€
Spezifikation
| Antigen | ATPAF1 |
|---|---|
| Applications | Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Produktcode | Marke | Quantity | Preis | Menge & Verfügbarkeit | |||||
|---|---|---|---|---|---|---|---|---|---|
| Produktcode | Marke | Quantity | Preis | Menge & Verfügbarkeit | |||||
|
18254323
|
Novus Biologicals
NBP2-55035 |
100 μL |
572.00€
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18631108
|
Novus Biologicals
NBP2-55035-25ul |
25 μL |
415.00€
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Beschreibung
ATPAF1 Polyclonal specifically detects ATPAF1 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Spezifikation
| ATPAF1 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| ATP synthase mitochondrial F1 complex assembly factor 1, ATP11 homolog, ATP11ATP11p, Atp11p, FLJ22351, homolog of yeast ATP11, MGC88060 | |
| ATPAF1 | |
| IgG | |
| Affinity Purified |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| 64756 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:KFDLIWNRAQSCPTFLCALPRREGYEFFVGQWTGTELHFTALINIQTRGEAAASQLILYHYPELKEE | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Haben Sie Verbesserungsvorschläge?Übermitteln Sie eine inhaltliche Korrektur
Berichtigung von Produktinhalten
Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.
Name des Produkts