missing translation for 'onlineSavingsMsg'
Learn More

ATP5F1 Antibody, Novus Biologicals™

Product Code. 18674656 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mL
25 μL
Unit Size:
0.1mL
25µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18674656 25 μL 25µL
18619417 0.1 mL 0.1mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Product Code. 18674656 Supplier Novus Biologicals Supplier No. NBP24925525ul

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Rabbit Polyclonal Antibody

ATP5F1 Polyclonal antibody specifically detects ATP5F1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry (Paraffin)
TRUSTED_SUSTAINABILITY

Specifications

Antigen ATP5F1
Applications Western Blot, Immunohistochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 0.04-0.4 μg/mL, Immunohistochemistry 1:500 - 1:1000, Immunocytochemistry/ Immunofluorescence 0.25-2 μg/mL, Immunohistochemistry-Paraffin 1:500 - 1:1000
Formulation PBS (pH 7.2), 40% Glycerol
Gene Alias ATP synthase B chain, mitochondrial, ATP synthase subunit b, mitochondrial, ATP synthase, H+ transporting, mitochondrial F0 complex, subunit b, ATP synthase, H+ transporting, mitochondrial F0 complex, subunit b, isoform 1, ATP synthase, H+ transporting, mitochondrial F0 complex, subunit B1, ATP synthase, H+ transporting, mitochondrial Fo complex, subunit B1, ATPase subunit b, cell proliferation-inducing protein 47, H+-ATP synthase subunit b, MGC24431, PIG47
Host Species Rabbit
Immunogen This antibody was developed against a recombinant protein corresponding to amino acids: LDYHISVQNMMRRKEQEHMINWVEKHVVQSISTQQEKETIAKCIADLKLLAKKAQAQPVM
Purification Method Immunogen affinity purified
Quantity 25 μL
Regulatory Status RUO
Research Discipline metabolism
Primary or Secondary Primary
Gene ID (Entrez) 515
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.