missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ASPA Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
484.00€
Specifications
| Antigen | ASPA |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
ASPA Polyclonal specifically detects ASPA in Human samples. It is validated for Western Blot.Specifications
| ASPA | |
| Polyclonal | |
| Rabbit | |
| P45381 | |
| 443 | |
| Synthetic peptides corresponding to ASPA(aspartoacylase (Canavan disease)) The peptide sequence was selected from the N terminal of ASPA. Peptide sequence RIFDLENLGKKMSEDLPYEVRRAQEINHLFGPKDSEDSYDIIFDLHNTTS. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| ACY-2, ACY2aminoacylase 2, Aminoacylase-2, ASPaminoacylase-2, aspartoacylase, aspartoacylase (aminoacylase 2, Canavan disease), EC 3.5.1.15 | |
| ASPA | |
| IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title