missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ARID1A Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
190.00€ - 550.00€
Specifications
| Antigen | ARID1A |
|---|---|
| Dilution | Western Blot 1:500 - 1:2000, ELISA |
| Applications | ELISA, Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
30229890
|
Novus Biologicals
NBP3-35884-100ul |
100 μL |
550.00€
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
30229973
|
Novus Biologicals
NBP3-35884-20ul |
20 μL |
190.00€
20µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
ARID1A Polyclonal antibody specifically detects ARID1A in Human,Mouse,Rat samples. It is validated for ELISA,Western BlotSpecifications
| ARID1A | |
| ELISA, Western Blot | |
| Unconjugated | |
| Rabbit | |
| Signal Transduction | |
| PBS (pH 7.3), 50% glycerol | |
| 8289 | |
| IgG | |
| Affinity purified |
| Western Blot 1:500 - 1:2000, ELISA | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human, Mouse, Rat | |
| ARID domain-containing protein 1A, AT rich interactive domain 1A (SWI- like), AT rich interactive domain 1A (SWI-like), AT-rich interactive domain-containing protein 1A, B120SWI-like protein, BAF250a, BAF250SWI/SNF complex protein p270, BM029, brain protein 120, BRG1-associated factor 250, BRG1-associated factor 250a, C10rf4, C1orf4SWI/SNF-related, matrix-associated, actin-dependent regulator of chromatinsubfamily F member 1, chromatin remodeling factor p250, hELD, hOSA1, matrix associated, actin dependent regulator of chromatin, Osa homolog 1, OSA1, OSA1 nuclear protein, P270, SMARCF1, subfamily f, member 1 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 2195-2285 of human ARID1A (NP_006006.3).,, Sequence:, LLGFLEDSLAATQFQQSQASLLHMQNPPFEPTSVDMMRRAARALLALAKVDENHSEFTLYESRLLDISVSPLMNSLVSQVICDVLFLIGQS | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title