missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ ARF6 (Human) Recombinant Protein

Human ARF6 full-length ORF ( AAH08918, 1 a.a. - 175 a.a.) recombinant protein with GST-tag at N-terminal.

Brand:  Abnova™ H00000382-P01.25ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16101811

  • 508.00€ / 25µg
Estimated Shipment: 30-07-2024
to see stock.
Add to basket

Description

Description

  • Sequence: MGKVLSKIFGNKEMRILMLGLDAAGKTTILYKLKLGQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLIFVVDCADRDRIDEARQELHRIINDREMRDAIILIFANKQDLPDAMKPHEIQEKLGLTRIRDRNWYVQPSCATSGDGLYEGLTWLTSNYKS
Specifications

Specifications

AAH08918
ADP-ribosylation factor 6
125% SDS-PAGE Stained with Coomassie Blue
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
ARF6
GST
382
Wheat germ expression system
25 μg
DKFZp564M0264
Wheat Germ (in vitro)
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer
Product Suggestions

Product Suggestions

Videos
SDS
Documents

Documents

Certificates
Special Offers

Special Offers