missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Aquaporin-3 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
379.00€ - 523.95€
Specifications
| Antigen | Aquaporin-3 |
|---|---|
| Dilution | Immunohistochemistry 1:1000 - 1:2500, Immunocytochemistry/Immunofluorescence 1-4 ug/ml, Immunohistochemistry-Paraffin 1:1000 - 1:2500 |
| Applications | Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18472422
|
Novus Biologicals
NBP2-33872-25ul |
25 μL |
379.00€
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18766283
|
Novus Biologicals
NBP2-33872 |
0.1 mL |
554.00€ 523.95€ / 0.10mL Save 30.05€ 5% Off |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
Aquaporin-3 Polyclonal specifically detects Aquaporin-3 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
| Aquaporin-3 | |
| Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| Human | |
| Q92482 | |
| 360 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: QLMIGCHLEQPPPSNEEENVKLAHVKHKEQI | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Immunohistochemistry 1:1000 - 1:2500, Immunocytochemistry/Immunofluorescence 1-4 ug/ml, Immunohistochemistry-Paraffin 1:1000 - 1:2500 | |
| Polyclonal | |
| Rabbit | |
| Membrane Trafficking and Chaperones | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| AQP-3, Aquaglyceroporin-3, aquaporin 3, aquaporin 3 (GIL blood group), aquaporin 3 (Gill blood group), aquaporin-3, GIL, Gill blood group | |
| AQP3 | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title