missing translation for 'onlineSavingsMsg'
Learn More
Learn More
APXL Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-13308
This item is not returnable.
View return policy
Description
APXL Polyclonal specifically detects APXL in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
Specifications
| APXL | |
| Polyclonal | |
| Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:50-1:200 | |
| Q13796 | |
| SHROOM2 | |
| This antibody was developed against a recombinant protein corresponding to the amino acids: PPLLIQDEDSTRIERVMDNNTTVKMVPIKIVHSESQPEKESRQSLACPAEPPALPHGLEKDQIKTLSTSEQFYS | |
| 0.1 mL | |
| Vision | |
| 357 | |
| Human | |
| IgG |
| Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| apical protein, Xenopus laevis-like, apical protein-like (Xenopus laevis), Apical-like protein, APX homolog of Xenopus, APXLHSAPXL, DKFZp781J074, FLJ39277, Protein APXL, protein Shroom2, shroom family member 2 | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction