missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Apolipoprotein L5 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
483.00€
Specifications
| Antigen | Apolipoprotein L5 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
Apolipoprotein L5 Polyclonal specifically detects Apolipoprotein L5 in Human samples. It is validated for Western Blot.Specifications
| Apolipoprotein L5 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| apolipoprotein L, 5, apolipoprotein L5, Apolipoprotein L-V, APOLV, APOL-V | |
| APOL5 | |
| IgG | |
| 47 kDa |
| Western Blot | |
| Unconjugated | |
| RUO | |
| NP_085145 | |
| 80831 | |
| Synthetic peptide directed towards the C terminal of human APOL5. Peptide sequence: PVVEHQPRLGPGVALRTPKRTVSAPRMLGHQPAPPAPARKGRQAPGRHRQ | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title