missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Apolipoprotein C-II/ApoC2 Antibody - BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
193.00€ - 463.00€
Specifications
| Antigen | Apolipoprotein C-II/ApoC2 |
|---|---|
| Dilution | Western Blot 1:100 - 1:500 |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18649190
|
Novus Biologicals
NBP2-92374-0.02ml |
0.02 mL |
193.00€
0.02mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18660731
|
Novus Biologicals
NBP2-92374-0.1ml |
0.1 mL |
463.00€
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
Apolipoprotein C-II/ApoC2 Polyclonal antibody specifically detects Apolipoprotein C-II/ApoC2 in Human, Rat samples. It is validated for Western BlotSpecifications
| Apolipoprotein C-II/ApoC2 | |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| Lipid and Metabolism | |
| PBS with 50% glycerol, pH7.3. | |
| 344 | |
| IgG | |
| Affinity purified |
| Western Blot 1:100 - 1:500 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human, Rat | |
| APC2, APOC2, Apo-CII, ApoC-II, Apolipoprotein C2, apolipoprotein C-II, MGC75082 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 1-101 of human APOC2 (NP_000474.2). MGTRLLPALFLVLLVLGFEVQGTQQPQQDEMPSPTFLTQVKESLSSYWESAKTAAQNLYEKTYLPAVDEKLRDLYSKSTAAMSTYTGIFTDQVLSVLKGEE | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title