missing translation for 'onlineSavingsMsg'
Learn More

tyrosine kinase 2, Mouse, Clone: 5A4, Abnova™

Mouse monoclonal antibody raised against a partial recombinant TYK2.

Brand: Abnova H00007297-M02.100ug

Additional Details : Weight : 0.00010kg

Product Code. 16197135

Quantity
Estimated Shipment
26-09-2019

Add to basket

Description

Sequence: PVCHLRLLAQAEGEPCYIRDSGVAPTDPGPESAAGPPTHEVLVTGTGGIQWWPVEEEVNKEEGSSGSSGRNPQASLFGKKAKAHKAFGQPADRPREPLWA

Specifications

Antigen	tyrosine kinase 2
Clone	5A4
Description	Mouse monoclonal antibody raised against a partial recombinant TYK2.
Gene	TYK2
Format	Affinity Purified
Gene Symbols	TYK2
Immunogen	TYK2 (AAH14243, 276 a.a. ~ 375 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Purification Method	Protein A column
Regulatory Status	RUO
Storage Requirements	Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Primary or Secondary	Primary
Gene ID (Entrez)	7297

Applications	ELISA, Immunofluorescence, Immunohistochemistry (PFA fixed), Western Blot
Conjugate	Unconjugated
Formulation	In 1X PBS, pH 7.4
Gene Accession No.	BC014243
Gene Alias	JTK1
Host Species	Mouse
Isotype	IgG2a Kappa
Quantity	100 ug
Research Discipline	Kinases
Whole Molecule	Y
Monoclonal or Polyclonal	Monoclonal
Target Species	Human

Description