missing translation for 'onlineSavingsMsg'
Learn More

ribosomal protein S6 kinase, 90kDa, polypeptide 6, Mouse, Clone: 6F2, Abnova™

Product Code. 16155876
Change view
Click to view available options
Quantity:
100 μg
Unit Size:
100µg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
16155876 100 μg 100µg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 16155876 Supplier Abnova Supplier No. H00027330M02.100ug

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Mouse monoclonal antibody raised against a partial recombinant RPS6KA6.

Sequence: RIGNGKFSLSGGNWDNISDGAKDLLSHMLHMDPHQRYTAEQILKHSWITHRDQLPNDQPKRNDVSHVVKGAMVATYSALTHKTFQPVLEPVAASSLAQRRSMKKRTSTGL

Specifications

Antigen ribosomal protein S6 kinase, 90kDa, polypeptide 6
Applications ELISA, Immunohistochemistry (PFA fixed), Western Blot
Classification Monoclonal
Clone 6F2
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a partial recombinant RPS6KA6.
Formulation PBS with no preservative; pH 7.4
Gene RPS6KA6
Gene Accession No. NM_014496
Gene Alias RSK4
Gene Symbols RPS6KA6
Host Species Mouse
Immunogen RPS6KA6 (NP_055311.1, 636 a.a. ∼ 745 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Purification Method Affinity Purified
Quantity 100 μg
Regulatory Status RUO
Research Discipline Kinases
Whole Molecule Yes
Primary or Secondary Primary
Gene ID (Entrez) 27330
Target Species Human, Rat
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Isotype IgG2a κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.