missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
Aminopeptidase PILS/ARTS1 Polyclonal specifically detects Aminopeptidase PILS/ARTS1 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.
Specifications
Specifications
| Antigen | Aminopeptidase PILS/ARTS1 |
| Applications | Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Dilution | Immunocytochemistry/Immunofluorescence 1-4 ug/ml |
| Formulation | PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide |
| Gene Alias | Adipocyte-derived leucine aminopeptidase, A-LAPALAP, Aminopeptidase PILS, ARTS1aminopeptidase regulator of TNFR1 shedding, ARTS-1PILSAP, EC 3.4.11, EC 3.4.11.-, EC 3.4.11.1, endoplasmic reticulum aminopeptidase 1, endoplasmic reticulum aminopeptidase associated with antigen processing, ERAAP1, KIAA0525APPILS, PILS-APERAAP, Puromycin-insensitive leucyl-specific aminopeptidase, Type 1 tumor necrosis factor receptor shedding aminopeptidase regulator |
| Gene Symbols | ERAP1 |
| Host Species | Rabbit |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:FQLVSIGKLSIEKALDLSLYLKHETEIMPVFQGLNELIPMYKLMEKRDMNEVETQFKAFLIRLLRDLIDKQTWTDEGSVSERMLRSQLLLLACVHNYQPCVQRAEGYFRKWKESNGNLS |
| Show More |
For Research Use Only
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?