missing translation for 'onlineSavingsMsg'
Learn More

alpha-Defensin 1 Antibody - Azide and BSA Free, Novus Biologicals™

Product Code. 18652598 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
100 μg
20 μg
Unit Size:
100µL
20µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18652598 100 μg 100µL
18605967 20 μg 20µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Product Code. 18652598 Supplier Novus Biologicals Supplier No. NBP305562100ul

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Rabbit Polyclonal Antibody

alpha-Defensin 1 Polyclonal antibody specifically detects alpha-Defensin 1 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunocytochemistry/ Immunofluorescence
TRUSTED_SUSTAINABILITY

Specifications

Antigen alpha-Defensin 1
Applications Western Blot, Immunofluorescence
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:500 - 1:1000, Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
Formulation PBS with 50% glycerol, pH7.3.
Gene Alias alpha 2, DEF1DEFA1B, DEFA2, defensin, alpha 1, myeloid-related sequence, defensin, alpha 1HP-1, HNP-1HP1, MRSMGC138393, myeloid-related sequence, neutrophil defensin 1
Host Species Rabbit
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-94 of human alpha-Defensin 1 (NP_004075.1). MRTLAILAAILLVALQAQAEPLQARADEVAAAPEQIAADIPEVVVSLAWDESLAPKHPGSRKNMACYCRIPACIAGERRYGTCIYQGRLWAFCC
Purification Method Affinity purified
Quantity 100 μg
Regulatory Status RUO
Research Discipline Apoptosis, Cancer, Signal Transduction
Primary or Secondary Primary
Gene ID (Entrez) 1667
Target Species Human, Mouse, Rat
Content And Storage Store at -20°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.