missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
alpha-Defensin 1 Polyclonal antibody specifically detects alpha-Defensin 1 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunocytochemistry/ Immunofluorescence
Specifications
Specifications
| Antigen | alpha-Defensin 1 |
| Applications | Western Blot, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Dilution | Western Blot 1:500 - 1:1000, Immunocytochemistry/ Immunofluorescence 1:50 - 1:200 |
| Formulation | PBS with 50% glycerol, pH7.3. |
| Gene Alias | alpha 2, DEF1DEFA1B, DEFA2, defensin, alpha 1, myeloid-related sequence, defensin, alpha 1HP-1, HNP-1HP1, MRSMGC138393, myeloid-related sequence, neutrophil defensin 1 |
| Host Species | Rabbit |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1-94 of human alpha-Defensin 1 (NP_004075.1). MRTLAILAAILLVALQAQAEPLQARADEVAAAPEQIAADIPEVVVSLAWDESLAPKHPGSRKNMACYCRIPACIAGERRYGTCIYQGRLWAFCC |
| Purification Method | Affinity purified |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?