missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Alpha Actinin 3 Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-92608-0.1ml
This item is not returnable.
View return policy
Description
Alpha Actinin 3 Polyclonal antibody specifically detects Alpha Actinin 3 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Specifications
| Alpha Actinin 3 | |
| Polyclonal | |
| Western Blot 1:500 - 1:2000, Immunohistochemistry 1:100 - 1:500, Immunohistochemistry-Paraffin | |
| actinin, alpha 3, alpha-actinin skeletal muscle, Alpha-actinin skeletal muscle isoform 3, alpha-actinin-3, F-actin cross-linking protein, MGC117002, MGC117005 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 580-630 of human ACTN3 (NP_001095.2). GAIMGIQGEIQKICQTYGLRPCSTNPYITLSPQDINTKWDMVRKLVPSCDQ | |
| 0.1 mL | |
| Apoptosis, Cell Biology, Cytoskeleton Markers, Immunology, Signal Transduction | |
| 89 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS with 50% glycerol, pH7.3. | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human, Mouse, Rat | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction