missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
Alpha Actinin 3 Polyclonal antibody specifically detects Alpha Actinin 3 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Specifications
Specifications
| Antigen | Alpha Actinin 3 |
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Dilution | Western Blot 1:500 - 1:2000, Immunohistochemistry 1:100 - 1:500, Immunohistochemistry-Paraffin |
| Formulation | PBS with 50% glycerol, pH7.3. |
| Gene Alias | actinin, alpha 3, alpha-actinin skeletal muscle, Alpha-actinin skeletal muscle isoform 3, alpha-actinin-3, F-actin cross-linking protein, MGC117002, MGC117005 |
| Host Species | Rabbit |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 580-630 of human ACTN3 (NP_001095.2). GAIMGIQGEIQKICQTYGLRPCSTNPYITLSPQDINTKWDMVRKLVPSCDQ |
| Purification Method | Affinity purified |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?