missing translation for 'onlineSavingsMsg'
Learn More

Alpha Actinin 3 Antibody - Azide and BSA Free, Novus Biologicals™

Product Code. 18612852 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.02 mL
0.1 mL
Unit Size:
0.02mL
0.1mL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18612852 0.02 mL 0.02mL
18676332 0.1 mL 0.1mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Product Code. 18612852 Supplier Novus Biologicals Supplier No. NBP2926080.02ml

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Rabbit Polyclonal Antibody

Alpha Actinin 3 Polyclonal antibody specifically detects Alpha Actinin 3 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
TRUSTED_SUSTAINABILITY

Specifications

Antigen Alpha Actinin 3
Applications Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:500 - 1:2000, Immunohistochemistry 1:100 - 1:500, Immunohistochemistry-Paraffin
Formulation PBS with 50% glycerol, pH7.3.
Gene Alias actinin, alpha 3, alpha-actinin skeletal muscle, Alpha-actinin skeletal muscle isoform 3, alpha-actinin-3, F-actin cross-linking protein, MGC117002, MGC117005
Host Species Rabbit
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 580-630 of human ACTN3 (NP_001095.2). GAIMGIQGEIQKICQTYGLRPCSTNPYITLSPQDINTKWDMVRKLVPSCDQ
Purification Method Affinity purified
Quantity 0.02 mL
Regulatory Status RUO
Research Discipline Apoptosis, Cell Biology, Cytoskeleton Markers, Immunology, Signal Transduction
Primary or Secondary Primary
Gene ID (Entrez) 89
Target Species Human, Mouse, Rat
Content And Storage Store at -20°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.