missing translation for 'onlineSavingsMsg'
Learn More
Learn More
alcohol dehydrogenase 4 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
484.00€
Specifications
| Antigen | alcohol dehydrogenase 4 |
|---|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Form | Purified |
Description
alcohol dehydrogenase 4 Polyclonal specifically detects alcohol dehydrogenase 4 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| alcohol dehydrogenase 4 | |
| Polyclonal | |
| Purified | |
| RUO | |
| P08319 | |
| 127 | |
| Synthetic peptides corresponding to ADH4(alcohol dehydrogenase 4 (class II), pi polypeptide) The peptide sequence was selected from the middle region of ADH4. Peptide sequence NSEKFVKAKALGATDCLNPRDLHKPIQEVIIELTKGGVDFALDCAGGSET. | |
| Primary |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| Rabbit | |
| Lipid and Metabolism | |
| ADH-2, alcohol dehydrogenase 4, alcohol dehydrogenase 4 (class II), pi polypeptide, Alcohol dehydrogenase class II pi chain, aldehyde reductase, EC 1.1.1, EC 1.1.1.1 | |
| ADH4 | |
| IgG | |
| Protein A purified |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title