missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Custom Products and Services
  4. Custom Enzymes and Inhibitors
  5. R&D Systems™ AKT1/2/3 Inhibitor Peptide Set

R&D Systems™ AKT1/2/3 Inhibitor Peptide Set

Código de producto. 18145235 Tienda Bio Techne Productos
Cambiar vista
Click to view available options
Quantity:
2 mg
5 mg
Tamaño de la unidad:
2mg
5mg
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Código de producto. Quantity Tamaño de la unidad
18145235 2 mg 2mg
18115332 5 mg 5mg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Este artículo no se puede devolver. Vea la política de devoluciones
Código de producto. 18145235 Proveedor R&D Systems™ N.º de proveedor NBP229332
 Restricted Item
Estimated Shipment: 13-11-2026
Añadir a la cesta
Añadir a la cesta

missing translation for 'validMainframeMsg'

Este artículo no se puede devolver. Vea la política de devoluciones

Descripción

A Novus product, part of R&D Systems. For use in research applications

TRUSTED_SUSTAINABILITY

Especificaciones

Host Species Human
Components Akt (Isoforms 1,2,3) Inhibitor peptide: 2 x 1mg (lyophilized) DRQIKIWFQNRRMKWKKAVTDHPDRLWAWEKF (AKT sequence: AVTDHPDRLWAWEKF). Molecular weight: 4214. Antennapedia Control peptide: 2 x 1mg (lyophilized) DRQIKIWFQNRRMKWKK. Molecular weight: 2361
For Use With (Application) Inhibition of Akt kinase activity
Content And Storage Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.
Quantity 2 mg
Product Type AKT1/2/3 Inhibitor Peptide Set
Molecular Weight (g/mol) 4214
Product Line Novus
Inhibitors AKT1/2/3
Form Lyophilized

For Research Use Only

Título del producto
Seleccione un problema

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.