missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ADK Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
280.00€ - 572.00€
Tekniske data
| Antigen | ADK |
|---|---|
| Dilution | Immunohistochemistry, Immunohistochemistry-Paraffin 1:20 - 1:50 |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Produktkode | Brand | Quantity | Pris | Antal & tilgængelighed | |||||
|---|---|---|---|---|---|---|---|---|---|
| Produktkode | Brand | Quantity | Pris | Antal & tilgængelighed | |||||
|
18108588
|
Novus Biologicals
NBP2-38410 |
0.1 mL |
572.00€
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18686515
|
Novus Biologicals
NBP2-38410-25ul |
25 μL |
280.00€
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Beskrivelse
ADK Polyclonal specifically detects ADK in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Tekniske data
| ADK | |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| Human | |
| P55263 | |
| 132 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: CIGIDKFGEILKRKAAEAHVDAHYYEQNEQPTGTCAACITGDNRSLIANLAAANCYKKEKHLDLEKNWMLVEKARVCYIAGF | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Immunohistochemistry, Immunohistochemistry-Paraffin 1:20 - 1:50 | |
| Polyclonal | |
| Rabbit | |
| Lipid and Metabolism | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| adenosine kinase, AKAdenosine 5'-phosphotransferase, EC 2.7.1, EC 2.7.1.20 | |
| ADK | |
| IgG | |
| Affinity Purified |
Ser du en mulighed for forbedring?Del en indholdskorrektion
Korrektion af produktindhold
Dit input er vigtigt for os. Udfyld denne formular for at give feedback relateret til indholdet på dette produkt.
Produkttitel